Octordle Answer Today : Wednesday ( 08 November 2023 ) Eight Latter Wordle Puzzle Game, hints, solution

In this article, we have given you detailed information about the octordle daily sequence answer, octordle sequence, octordle answer today Fortnite, octordle sequence hint, and octordle rescue. Octerdoodle is a game where you must guess eight words of 5 letters at a time and have only 13 attempts. This game is an ultimate wordall challenge, also known as a wordall puzzle game for evil and genius. Octordle is a web-based 8, unique 5-letter word guessing game that is free to play, where players have to take six tries to guess a five-letter word. The developer of this game, Kenneth Crawford, releases eight daily word puzzles to solve; here, we get the answers to all today’s puzzles for free. Nowadays, the Octordle puzzle online game has become very popular, although this game was initially played most in America.

Octordle Answer Today 2023

Octordle is a web-based game. In which players are given 13 attempts to guess correctly. Octordle Team” releases different puzzles daily at midnight for Octordle players. We have provided information about Octordle Answers in this article today.

The Octordle team releases word puzzles to solve every day, and here we have the answers to all of today’s puzzles for free. On this page, we have listed all Octordle game lists, unlimited answer keys, all answer solution collection lists, and complete instructions on how to play the Octordle game.

Octordle Answers Today – Overview

Kenneth Crawford designed the game Octordle. This game is similar to the Worldly game based on a puzzle. Puzzle games develop the logical abilities of users. Below are step-by-step instructions on how to solve the puzzle. Our team has tested all Octordle 1st Players Names puzzle solution lists, which are 100% accurate.

Game NameOctordle     –  Eight Letter wordle Game
Created ByKenneth Crawford 
Sessions2023
Octordle Today Answer08 November 2023
New puzzle time12.00 AM
CategoryEntertainment
Official WebsiteOctordle.com

Octordle Today Answer List 2023

Today, we have told you about the answer to Octordle. If you are also one of those people who like to play crosswords published in newspapers, you have come to the right website. In today’s article, we will tell you how to choose the correct answer so that you can solve any puzzle in minutes. So let us know how the Octordle puzzle can be solved quickly. Below are step-by-step instructions on how to solve the puzzle. Our team has tested all Octordle players’ name puzzle solution lists, and they are 100% correct.

Octordle Answer Today

Octordle Word DateOctordle Answers List 2023
08 November 2023DUSTY, UTILE, DRYER, WIDEN, GRASP, SULKY, HASTY, VERGE
07 November 2023AWARE, FEIGN, MEANT, FIRST, STALL, FROND, STOOP, HOVEL
06 November 2023SALVE, SHORT, FLING, BLAST, REVUE, TRACT, DONOR, FRONT
04 November 2023VAUNT, CABLE, INERT, PIPER, IDLER, VAPOR, LEARN, SCOUT
03 November 2023BRACE, PHOTO, DISCO, STALK, DOPEY, KARMA, DEFER, CRICK
02 November 2023HIPPY, BROOD, MECCA, STUCK, FLOOD, DEBUT, STUNG, WHEAT
01 November 2023VERGE, BETEL, KNEEL, GLYPH, PURER, ANKLE, UNION, FLEET
31th October 2023ANODE, BRING, ACORN, FINCH, CRASS, VALOR, CLEFT, PATCH
30th October 2023RANCH, LEANT, PENAL, OUTDO, DOWDY, PALER, SHAPE
29th October 2023SETUP, EAGLE, GOURD, ETHOS, TWEED, AVAIL, GROWL, BUDDY
28th October 2023RAVEN, WOKEN, CURIO, MOTOR, FLARE, WHICH, SPELL, TRYST
27th October 2023HORSE, LOYAL, STAIN, OCEAN, TRITE, LOATH, WOKEN, AGONY
26th October 2023OTTER, LIMIT, CRUST, APART, LEACH, ALIBI, OFFER, GRAPE
25th October 2023WEAVE, HUMOR, SALLY, RULER, REPEL, FEMME, EXACT, FLUME
24th October 2023CYBER,PERKY, TOAST, SLICK, GOLEM, VOWEL, FLAIL, DREAM
23th October 2023ASSET, THUMB, WHOSE, PIXIE, NYLON, LAUGH, AGONY, NYMPH
22th October 2023CANDY, SPOKE, CRYPT, FREAK, CHILI, ALBUM, NEWLY, ITCHY
21th October 2023PRUDE, RIGOR, SHOCK, GRUFF, ABODE, GOODY, AWARE, FEIGN
20th October 2023CLUMP, PINCH, GROOM, BIGOT, PLATE, FUNKY, BLEEP, VERVE
19th October 2023SPACE, ROYAL, FRAME, DEVIL, EPOCH, DANDY, TUBAL, SENSE
18th October 2023GUPPY, PESKY, CREST, JUDGE, FIXER, LILAC, RURAL, CLASS
17th October 2023CIVIL, LUNCH, CAIRN, PROOF, SLOSH, SCARF, BANAL, TITLE
16th October 2023CRUST, WAIVE, Gusty, START , SLUNG, TENSE, SWASH, ICING
15th October 2023SHACK, EXIST, NOTCH,  ROTOR, BEGAT, TITAN,  SMITH, CRAMP
14th October 2023MOODYPRICESHIRERUDDYRUDERADOREWEEDYBITTY
13th October 2023KARMAFOLLYKHAKISHORTMATEYTATTYRANCHLEANT
12th October 2023BLIMPDATUMPLANTSWEETSQUIBSMOCKBURSTLOAMY
11th October 2023PULPYWHEREBELLYNICHERABIDAGLOWCUMINPITHY
10th October 2023COURTSMASHMOOSETANGYPIECELEVELRAJAHHARRY
9th October 2023FLACKREFERSPIKYSHINEMOUNTDILLYDOPEYBLUER
7th October 2023NOISYPENCEKNOCKBARONSCRUMPAINTEARLYTAKER
6th October 2023COLORRAPIDREUSENURSETAFFYSNARLASSETTHUMB
5th October 2023LEAFYGAWKYMINUSTRAWLSUITEFEWERWHEATSHOWN
4th October 2023CLASSSLIMECRISPLARVAOPTICWHACKBERETKRILL
2nd October 2023MOSSYBASISRALLYASCOTMAMMAOVINESPACEROYAL
30th September 2023THUMPSLOTHCHOSEKIOSKMAUVECLEANCRUSTWAIVE
29th September 2023GENIESTRAPSHIRKHAPPYTOUGHTWEEDCIVILLUNCH
28th September 2023FETIDILIACSTATEWOKENSUGARFINERAUDITFRIAR
27th September 2023JUMBOLEECHROVERPLANEBULKYCHINAMURKYLOOSE
26th September 2023USAGEEVICTRACERGUSTOSINGETOXICBREAKEASEL
25th September 2023FIZZYWHOLETITANSILKYJELLYGECKOGULLYYOUNG
23rd September 2023DUMPYKNOLLSADLYSHYLYTROLLBEEFYPROUDCHOKE
22nd September 2023STORYBOOZEAGATECHALKLIGHTARDORANGSTSPELL
21st September 2023DETOXJOLLYJUICEGORGEVAGUEPAGANHINGEDAUNT
20th September 2023POSERSALTYENACTGODLYBISONSHEERVIRUSROGUE
19th September 2023WORSEWOVENPOESYSPURNTIPSYFROWNADAGESWOON
18th September 2023MINUSTRAWLSUITEFEWERWHEATSHOWNSLANGSTRIP
17th September 2023FREAKPIVOTORBITMODALCLERKSCOOPBRANDDROLL
16th September 2023CHEATENJOYCHARMANGRYAVOIDIRATECRIEDTRACE
15th September 2023UNFEDSPICYTROPEPLEATPROSEWORLDBUGGYTWEET
14th September 2023STOODSANERALOFTWISERPLACEDELTAWIELDMAYBE
13th September 2023SATINSNOOPBILLYIONICHAUTEMETALTESTYELECT
12th September 2023QUASIRARERRURALLEAPTSHORNRASPYCHOREMIDGE
11th September 2023IVORYSWORDCOBRASLATECOCOATOKENTRYSTASIDE
10th September 2023BRINYSOAPYAPHIDGOUGESPIEDWACKYFLOWNANGEL
9th September 2023FRILLRUGBYULTRAHONEYTRUCETRULYPHONYCLOUT
8th September 2023LOSERMIMICGAMMAVIPERMINORSHARDERASEANNEX
7th September 2023GRANDSTRAYEXTOLPANICINEPTALONEACRIDBRAVE
6th September 2023SUNNYWORDYVALETINLETAPNEASUPERCRIMPLAPEL
5th September 2023WAXENRIDERDITTOLINGODRAWNSLOOPHOTLYCANNY
4th September 2023JUICEGORGEVAGUEPAGANHINGEDAUNTPIZZAUNZIP
3rd September 2023AXIONTENORSEVENSOLARDOWRYPOLYPDODGEWRYLY
2nd September 2023GOINGBAYOUSPAWNGEESETILDEADEPTWORSEWOVEN
1st September 2023DIRGECANONUNDERSPORECAGEYGIDDYFOUNDSPARK
31st August 2023SEDANSTAINPUNCHBASALBUNNYPIXELFREAKPIVOT
30th August 2023OLDERHOVERWRECKBRAVOAFTERCHEATENJOYCHARM
29th August 2023TAUNTSCARYLURIDTABBYALARMSPELLETHICLABOR
28th August 2023PUTTYTHUMBBANJORALLYMANORSTONYSANDYALOFT
27th August 2023VEGANAROMACOMMAEERIECRATEQUEUESNACKREMIT
26th August 2023BATTYCOMETLOOSETROVESKULKPLAINELOPEDOZEN
25th August 2023GREATPERKYBOWELEGRETBOOMYNEWLYRHINOAGILE
24th August 2023SUMACSPICYRETCHFLOUTANGELRADIOTAWNYACTOR
23rd August 2023TAPIRPATIOLAPELPHONECLOUTSTEERLYINGADMIN
22nd August 2023SNOUTBUGLEOMEGASEVENTAFFYCYNICMILKYGAMER
21st August 2023LEVERBLAMESHACKBOOTHWHARFHASTEBIRCHEAGER
19th August 2023HUMIDDRAWLSLINKSPOOLREALMQUOTAALGAEBEARD
17th August 2023FRIARGLOSSSURERDUMPYSEWERSUITEGUESTDROSS
16th August 2023HASTYLAGERTHICKSKULLERASECEASERISERMAJOR
15th August 2023REVUEDUCHYTALLYMAKERCLOSEINCURFOLIOABIDE
14th August 2023LEMURCAULKOWINGQUEENFIBERTONGASMOKECOLOR
12th August 2023DETERJOINTSHYLYTEMPOARENAFLUSHTAUNTSCARY
11th August 2023CRASHGRAVECOPSEMUSHYSKIERREACHTUNICSAVOR
10th August 2023GAWKYSMILERAYONCHAFFMACROCOVETREADYTWIRL
9th August 2023COMICOCCURSNEAKANTICAWARDSTANDBATTYCOMET
8th August 2023UNLITGUMBODECAYNOBLYKNELTPUPALBOTCHEXCEL
7th August 2023AXIALFABLEDEBUGDROWNSTILLSONICODDLYCATER
6th August 2023DIZZYDROOPHUMPHFRIEDCURVYULCERTAPIRPATIO
5th August 2023TRIADWIGHTTEETHPESKYREHABPROUDSYRUPCLIMB
4th August 2023MOULTICINGSUGARSKUNKSIRENTHORNBLARECOVER
3rd August 2023OFFERPLUMEBOBBYABHORFLANKFLAILSWATHSLIMY
2nd August 2023LINGODWELLREGALRIVERQUILLMANGASHEIKWEIRD
1st August 2023MOTIFQUELLGULCHGIANTMOOSESWIRLCIDERDRAFT
31st July 2023ELIDEPETALRASPYIDYLLSHOUTRATIOBEGUNTIMER
29th July 2023UNCUTGONERHIPPOCAMELGRIMEWOOLYWAFERLEVEL
28th July 2023DROOLCLINGNAVELSCIONPOINTSPREEPRIEDFROCK
27th July 2023SULKYCORNYPIANOMIRTHCREAMLUNGEMOTORCADDY
26th July 2023STOREMEATYPAPALFORGEVYINGSWASHCONCHEXTRA
25th July 2023STOODBOARDTAPERSWILLMACHORAVENRUMORCIVIC
24th July 2023CREEKVILLABLANDPROBESTASHTORUSGAWKYSMILE
22nd July 2023SWORNSAFERSHARKDERBYSLEPTWHINYUNLITGUMBO
21st July 2023KIOSKSHUCKMURKYSCALEFISHYMULCHSTATEPINCH
20th July 2023ANGLEHENCEBASTESPURTCHESSSCARFBYLAWKITTY
19th July 2023CHARTGRUELFAUNASULLYGUARDTACKYTHREECURIO
18th July 2023SUGARSKUNKSIRENTHORNBLARECOVERTERRAMETRO
17th July 2023INPUTTASTYHEDGEGROANCANNYAPPLEESSAYBOOZE
16th July 2023MOTTOYIELDCRUMBSPIRELARVAAWAITTHREWIDIOM
15th July 2023TUBALWREAKWORLDROBINALLEYPLUCKMOTIFQUELL
14th July 2023RASPYIDYLLSHOUTRATIOBEGUNTIMERADMITUTILE
13th July 2023LORRYBRACEDREAMSOUNDASSETFOUNDHUMORANVIL
12th July 2023WHEATTOOTHLODGEPAGANDETOXWHIRLCRONERUSTY
11th July 2023STICKTULIPRAINYLOWERSHEARAVIANBAGELFUROR
10th July 2023ELECTBORNEFOGGYWHERESTEEDROGUECOVENSPAWN
9th July 2023EMCEEDEMONCONDOTOPICREVELRENEWUPPERSTACK
8th July 2023CARRYCURVECLUMPSURGEFOAMYSTARKSTOODBOARD
7th July 2023TONICAWOKEHYPERTRIALLIMBOSHIRKREBARNAVAL
6th July 2023CRACKLOGICSTEADARGUEBREADINNERDENSESOLVE
5th July 2023ELITEENVOYBEASTSTOLEGRANDATOLLMARSHBOXER
4th July 2023LEAFYSTORYNICERDITTYBEECHOTHERKIOSKSHUCK
3rd July 2023VOTERREPELSTIFFQUITECLAMPMOURNSPASMROUGH
1st July 2023ROVERLANKYBOULEGUMMYWARTYGHOSTPIETYSUAVE
30th June 2023SKIFFPRIDESPEAKFINALILIACFACETGLAREBROOD
29th June 2023DENSEDAIRYCRATEBUDGEWROTESCALPFLESHSQUAT
28th June 2023STUNGLUSTYAPRONDEMURGLASSDEBITLINENDICEY
27th June 2023FLUMETODAYBLENDPOSERMINORWHEELLOGINTORSO
26th June 2023DREAMSOUNDASSETFOUNDHUMORANVILTROUTFORTH
25th June 2023LODGEPAGANDETOXWHIRLCRONERUSTYPITCHPHONY
24th June 2023VIDEOLEAVECRAFTGROVEFIFTYSLACKSTICKTULIP
23rd June 2023FOGGYWHERESTEEDROGUECOVENSPAWNASHENBEZEL
22nd June 2023MAYORFLUNKONSETFRONDSOAPYCELLOEMCEEDEMON
21st June 2023MAIZECRYPTPOISEDELVEREUSETEPIDSHARECRAWL
20th June 2023GRATEFIGHTVICARLOVERRODEDPOSITINTERJUICE
19th June 2023ANNOYQUARKSLUMPLOUSEWRATHAROSECRACKLOGIC
18th June 2023CRUDEABYSSSOBERHELLOBEACHSHALTELITEENVOY
17th June 2023YACHTMORALGOURDIMPELNERVECHESTFUNGIWHELP
16th June 2023PECANLOSERRERUNCYBERPEARLFJORDVOTERREPEL
15th June 2023CHOKEFLESHCREPTSMACKSUPERTRADECUBICEVADE
14th June 2023FROWNQUAKESTUDYMARCHBAGGYLIBELFRAMEIRONY
13th June 2023MODEMSERIFHARSHANGERDIARYMERITSKIFFPRIDE
12th June 2023CAVILSHORTVODKAHUNKYSTUNKSTORMDECRYBERRY
11th June 2023AMISSAGATETHROWHEISTTOASTBAKERCINCHFLUFF
10th June 2023UPSETJEWELLASSODAUNTUNIONPRIZEFLUMETODAY
9th June 2023TESTYTROOPIRATESTINKTIBIARULERGIDDYTABOO
8th June 2023LUCKYQUERYREPLYSHELLHERONGUSTOSPIKECRAZE
7th June 2023TRIEDHEAVYJELLYBASICBAWDYHALVEORBITBREED
6th June 2023FLOODRISKYVERSESOOTYMOISTSWEATANIMESQUAD
5th June 2023CACTIHILLYGUSTYBALERCREMELEASTBLUFFGRILL
4th June 2023EASELHOWDYSCANTCHAIRATTICSLUNGSWINGMARRY
3rd June 2023VICARLOVERRODEOPOSITINTERJUICECHARDALLOY
2nd June 2023SAUTEDRIEDSNOOPDRAINSCORETAROTPREENHUMUS
1st June 2023LUMENTIGHTVIOLABRAWLFLOWNMETALBUYERDRUID
31st May 2023SPOKEPARRYSETUPUSUALLADLECROCKDRIFTROUTE
28th May 2023BIDDYSCENTCREEPFEASTSANERFORGOPARERSLURP
27th May 2023SUNNYSHEEPSLAINPLUNKENSUECLIFFCHASEUTTER
26th May 2023WHACKPANELSNEERCOULDREACTDITTOCAVILSHORT
25th May 2023BURSTAUNTYSTERNSTAGECRUSHNINNYAGENTYOUNG
24th May 2023NEIGHFULLYBESETGODLYMEDALDOUBTFLIRTSLEEP
23rd May 2023WOUNDMIMICTANGOSIEVESLANGNEWERCRIMPPALER
22nd May 2023STOCKADOBESPEARMINTYJIFFYPINEYCHAINSALSA
20th May 2023VERSESOOTYMOISTSWEATANIMESQUADSTARTSPECK
19th May 2023TRACESPARKVAULTCABLEINEPTPINTOIDLERVAPID
18th May 2023SCANTCHAIRATTICSLUNGSWINGMARRYINFERPOKER
17th May 2023ALOUDTWANGCURRYSIXTHCROAKTABLETRIPEPRAWN
16th May 2023THIGHTHESEPOESYFUSSYSMOCKGRAILOCTETDINGY
15th May 2023MOGULBASINANODEBRINEACORNFINCHSOUTHVALID
14th May 2023MATCHTOPAZRAMENLEAKYPEDALPRIVYDUNCEDOUGH
13th May 2023LYMPHSEDANSTUCKAPTLYGLOBEULTRAGREEDCOUCH
12th May 2023OLDENCACHECOWERSCORNALTERHEARDALERTPOSSE
11th May 2023DINGOVISORYEASTRESINFLECKGRADEBIDDYSCENT
10th May 2023MANGEDIGITOTTERBLOWNCROSSSPIEDSMEARLEMON
9th May 2023MOTELDEIGNWEARYCLACKNOMADRUGBYCHALKFELON
8th May 2023PUPPYGRANTRUDERGOLEMLADENSLICERIDGEVOUCH
7th May 2023QUARTROBOTPURGETHRUMHOISTSEPIADRANKLIVID
6th May 2023VALUEDOGMAMYRRHVIRALDOWRYSHADYFLICKSNAIL
5th May 2023GENREMECCASWINEGRASPHEFTYCHASMPLUSHSHOWN
4th May 2023BLEEPVERSOROWDYUMBRAETHERMOWERMIDSTCAPER
3rd May 2023MAMMAOVERTSOWERROWERFRAILDEUCEEPOCHDANCE
2nd May 2023SPIELDRAKEWAGONMELONPENNESWEARSMITESCOUR
1st May 2023MAUVECLEANCRUSTWAISTSTINGFILLYMERCYTENOR

How to Play Octordle Game Online @Octordle.com

  • First of all, users must go to the Octordle game’s official website: Octordle.com.
  • After this, a game page will open in front of you. Players can choose from any of the 2 options, “Daily Octordal” or “Free Octordal”. By selecting the daily option, players will get unlimited puzzles daily.
  • Eight words – 5 letter puzzles will appear on the screen. Now, you will be given 13 chances to guess the correct answers.
  • Each guess must be a valid 5-letter word.
  • After guessing the correct answer, click on the submit button.
  • And finally, the color of the tiles tells you whether the answer is right/wrong or not.
Octordle  Official WebsiteClick Here
Latest Job DetalisClick Here

Leave a Comment